Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MAPAGRMGAADHDVIEQQLKETVQSLYQILVQVSAYDQHTSVSSGSNSTSAAPGAAANSTPTPTSQLSSSSSKPSAEVLAQELRTLSASLQAIHATASHPTPERSLPHIPPELVQYVENGRNPDIYTREFVEQVRRGNQLLRGKQVAFGRFRDILAGEMDSAMPELHDDVATVLEATGGRDRWKDTAPGGGGGAGASGANGTGAGASSSFGQGSSGNGGSAATPSGRALSGTPAP |
Length | 235 |
Position | Middle |
Organism | Microdochium bolleyi |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Xylariomycetidae> Xylariales> Microdochiaceae> Microdochium. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.446 |
Instability index | 44.48 |
Isoelectric point | 5.65 |
Molecular weight | 23991.95 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP06672 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 65.62| 19| 24| 189| 207| 1 --------------------------------------------------------------------------- 189- 207 (35.24/12.92) G.GGGGAGASGANGTGAGAS 211- 230 (30.38/10.29) GqGSSGNGGSAATPSGRALS --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 87.02| 23| 23| 55| 77| 2 --------------------------------------------------------------------------- 43- 67 (34.16/16.36) SSGSNSTSAapGA..AANSTPTPTSQL 68- 90 (34.05/16.28) SSSSSKPSA..EV..LAQELRTLSASL 91- 106 (18.81/ 6.03) QA...........ihATASHPTPERSL --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 51.94| 14| 26| 117| 130| 3 --------------------------------------------------------------------------- 117- 130 (26.61/21.12) VENGRNPDIYTREF 146- 159 (25.33/19.78) VAFGRFRDILAGEM --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) RDRWKDTA 2) SGANGTGAGASSSFGQGSSGNGGSAATPSGRALSGTPAP | 180 197 | 187 235 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab