<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06672
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MAPAGRMGAADHDVIEQQLKETVQSLYQILVQVSAYDQHTSVSSGSNSTSAAPGAAANSTPTPTSQLSSSSSKPSAEVLAQELRTLSASLQAIHATASHPTPERSLPHIPPELVQYVENGRNPDIYTREFVEQVRRGNQLLRGKQVAFGRFRDILAGEMDSAMPELHDDVATVLEATGGRDRWKDTAPGGGGGAGASGANGTGAGASSSFGQGSSGNGGSAATPSGRALSGTPAP |
| Length | 235 |
| Position | Middle |
| Organism | Microdochium bolleyi |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Xylariomycetidae> Xylariales> Microdochiaceae> Microdochium.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.446 |
| Instability index | 44.48 |
| Isoelectric point | 5.65 |
| Molecular weight | 23991.95 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP06672
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.62| 19| 24| 189| 207| 1
---------------------------------------------------------------------------
189- 207 (35.24/12.92) G.GGGGAGASGANGTGAGAS
211- 230 (30.38/10.29) GqGSSGNGGSAATPSGRALS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 87.02| 23| 23| 55| 77| 2
---------------------------------------------------------------------------
43- 67 (34.16/16.36) SSGSNSTSAapGA..AANSTPTPTSQL
68- 90 (34.05/16.28) SSSSSKPSA..EV..LAQELRTLSASL
91- 106 (18.81/ 6.03) QA...........ihATASHPTPERSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.94| 14| 26| 117| 130| 3
---------------------------------------------------------------------------
117- 130 (26.61/21.12) VENGRNPDIYTREF
146- 159 (25.33/19.78) VAFGRFRDILAGEM
---------------------------------------------------------------------------
|