<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06656
| Description |
"Mediator complex, subunit Med21" |
| Sequence | MGDRLTQLQDAVDQLATQMVASVHYLNRHHDLELLGPRDQINPAAVKAAGEGGGGGPGGGQPGLEDQKEIDAHPGDAFRASQLELARDLILKEQQIEYLVSILPGLLNSEQDQDRTIKELEEELKVAEQQRREAVREKEATMRRLDEVIRSIRRP |
| Length | 155 |
| Position | Middle |
| Organism | Microdochium bolleyi |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Xylariomycetidae> Xylariales> Microdochiaceae> Microdochium.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.715 |
| Instability index | 56.55 |
| Isoelectric point | 4.96 |
| Molecular weight | 17263.14 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP06656
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.96| 12| 33| 84| 95| 1
---------------------------------------------------------------------------
84- 95 (19.63/11.82) ELARDLILKEQQ
119- 130 (19.32/11.53) ELEEELKVAEQQ
---------------------------------------------------------------------------
|