<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06642

Description Mediator of RNA polymerase II transcription subunit 5
SequenceMEVTLANGNATKHRETTTQLVQASRTCAPTFPEHITTETTDPFPAVRRLKQVQNILLDFSDDLKPACNSTANMDGRVVRGVQRAALEQWSEFIAKSLAHRMDPEKFESYVPFLQAKHPLPPVAVADLFLRPQPHNHESLDPRVPRYLQVLSSLNYIDTPSILKALYKYSTSRGHSREAAQLPNAENQTSNSPRWESSYAAEEVMFYRLTKSVAQGTAIQNTGTGLEIANVMAKWIALFTDAATAFTVDVMGQLHNSQVREEMESARAAFVALLLGVCENQVVLKALSKPEAQEIRKALSESLANFVPTIMQSAGPIATRLDMFRTSTLAGFEPVDEQKNKSNAEIEDLFDSTVALENFVVSELPIVNSRAGLYIYLNAALVGRPLIDDLAIFNYLNNRYQGDVQSTTVDLILVSFDILANAASRNEGNQAAHLLRSFLMNKLPILIESLSKHMYGPVNAEYCITEALSRVDTTTFPTLSSMFDETRSNNPFTDSVREDFCWACCLHGLLRESSIETLLGETPYSSLPAGGRYVKENLVAECLADPERMQALIGELDSKEGNAGAVCQALTEVMGQLCRNKETMSLKLLCSQLAQKPLSLDVMLMFEKPATILHPLCDLLDNWKYDEDQGEYQPVYEEFGSILLLVMAFAYRYGLSASDMGIISSDSFVARLLGHGHQSRSLEELSDQEKGHLDGWIHGLFDSEAGGLGDELMSSCPPQDFYLLVSTLFHNIVLAFSTGHLTEESLRGGIEYLVDTFLLPSLVVAITSLANSLWVERSDCQKAIVRVLNSVLAPTSISNEAQAMLSSVMNIVAKPLEHSLRAYQRSDPKSQEVEPLLKAIKDSIPLSRRTGAADHQELDAWSMGGFSNSIRQTLQQLVQWSIHPTMDRMPPAYTHRQMLVAMKLLGAKRLLQLLYEEIRQQTETGSGSIIYDVATALVCAPDVVNTPSNPINFIDNSGNVPAPVQRKLTLREVLKSDAEECKKLQKVDMNLAEIVVRLYRKVETQMAVSQAEVIQADTMLQTDLGLSLDAGAGSLDDAMAAAAANVAQGDGMSVDNVSLDLGLGGVGGDLGLGGSSTNGGGSLDLGADDLFSGLGAGDDFQWDNMDLS
Length1107
PositionTail
OrganismColletotrichum salicis
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Glomerellales> Glomerellaceae> Colletotrichum> Colletotrichum acutatum species complex.
Aromaticity0.07
Grand average of hydropathy-0.118
Instability index43.95
Isoelectric point4.87
Molecular weight121329.36
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU364142

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP06642
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      89.67|      23|      23|    1048|    1070|       1
---------------------------------------------------------------------------
 1026- 1056 (30.25/15.14)	SLDAGAGSL..DDAmaaaaanvaqGDGMSVDNV
 1057- 1080 (18.92/ 6.67)	SLDLGLGGVGGDLG...lggsstnGGG......
 1081- 1104 (40.50/22.79)	SLDLGADDLFSGLG.........aGDDFQWDNM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      81.73|      27|      51|     377|     404|       2
---------------------------------------------------------------------------
  378-  404 (46.73/24.56)	AALVGRP.LIDDLAIF.NYLNNRYQGDVQ
  430-  458 (35.00/15.82)	AAHLLRSfLMNKLPILiESLSKHMYGPVN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.87|      21|      25|     305|     329|       3
---------------------------------------------------------------------------
  302-  323 (33.68/18.62)	LAnFVPTIMQSAGPIATRLDMF
  328-  349 (30.19/27.70)	LAgFEPVDEQKNKSNAEIEDLF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.42|      12|      27|     758|     770|       4
---------------------------------------------------------------------------
  758-  770 (16.21/14.60)	LPSlVVAITSLAN
  787-  798 (21.21/13.67)	LNS.VLAPTSISN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.49|      19|      27|     571|     592|       5
---------------------------------------------------------------------------
  571-  591 (29.43/24.19)	EVMgqLCRNKETMSLKLLCSQ
  600-  618 (36.06/20.88)	DVM..LMFEKPATILHPLCDL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      33.37|      10|      32|    1005|    1014|       8
---------------------------------------------------------------------------
 1005- 1014 (16.92/ 8.99)	MAVSQAEVIQ
 1038- 1047 (16.45/ 8.56)	MAAAAANVAQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP06642 with Med5 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MEVTLANGNATKHRETTTQLVQASRTCAPTFPEHITTETT
1
40










Molecular Recognition Features






MoRF SequenceStartStop




1) AGDDFQWDNMDL
1095
1106