<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06625
| Description |
"Mediator complex, subunit Med21" |
| Sequence | MADILTQLQTCLDQLATQFYATLGYLTTYHDNAPTTPPPNVPDAVPALAKIAKNSSAPPVPAAIANKAGGAAAVAGNASPPQAPPQQPGAAPGTAREGDDPNLPPAPDSPRTFASRQRELARDLIIKEQQIEYLISVLPGIGASEAEQETRIRELETELRDVEKERAAKVRELKKLRTRLEDVLGAVAVGIHGDGYPRR |
| Length | 199 |
| Position | Middle |
| Organism | Penicillium patulum (Penicillium griseofulvum) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.442 |
| Instability index | 56.15 |
| Isoelectric point | 5.50 |
| Molecular weight | 21181.65 |
| Publications | PubMed=26729047
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP06625
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 67.21| 18| 19| 145| 162| 1
---------------------------------------------------------------------------
127- 141 (16.59/10.11) ...KEQQIEYLI...SVLPGI
145- 162 (28.82/22.71) EAEQETRIRELE...TELRDV
163- 183 (21.80/15.48) EKERAAKVRELKklrTRLEDV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 110.92| 29| 40| 33| 63| 2
---------------------------------------------------------------------------
33- 61 (53.53/24.66) APTTPPPNVPDAVPALAKIAKNSSAPPVP
79- 107 (57.39/22.48) SPPQAPPQQPGAAPGTAREGDDPNLPPAP
---------------------------------------------------------------------------
|