<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06620
Description |
Uncharacterized protein |
Sequence | MSLTNPPSSSGSLSRTRVGNLKRSLQATVDDAIESRRPGGYTSKVRVRDRYNIVGFISSGTYGRVYKAVGKNGKKGEFAIKKFKPDKEGETIQYTGLSQSAIREMALCTELSHANVVQLEEIILEDKCIFMVFEYTEHDLLQIIHHHTQPQRHAIPATMVRSIMFQLLNGLLYLHTNWVLHRDLKPANILVTSSGAIRIGDLGLARLFYKPLNSLFSGDKVVVTIWYRAPELLMGSRHYTPAVDMWAIGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMMKIVEILGLPRKESWPGLASMPEYSQLQSLVLHRQPSHFHRSSNLEGWYQSCLKNGGYTSTSSAGTPGADGFDLLSRMLEYDPAKRLTAEQALEHPYFTNGGPISGNCFEGIEGKYPHRRVTQDDNDIRSGSLPGTKRSGLPDDSLMRASKRLKE |
Length | 437 |
Position | Kinase |
Organism | Penicillium patulum (Penicillium griseofulvum) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.390 |
Instability index | 45.56 |
Isoelectric point | 9.34 |
Molecular weight | 49020.61 |
Publications | PubMed=26729047
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP06620
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 119.55| 37| 85| 202| 251| 1
---------------------------------------------------------------------------
202- 251 (57.53/56.61) LGLARLF..........YKPLNSLfsgdkvvvtIWYRAPELLmgsrHYTPAVDMWAIGCI
289- 335 (62.02/34.87) LGLPRKEswpglasmpeYSQLQSL.........VLHRQPSHF....HRSSNLEGWYQSCL
---------------------------------------------------------------------------
|