<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06612

Description RNA polymeras-like protein II mediator complex component Srb8
SequenceMTSRIVGPPGREPLQRSFSSSTTTFSRPSPHRTLSQKFPSSSPTRRTNDVLIDLTVDADAAGRHAPRIGTSRLRLEVSTDSKSALVESPAPTSDSTSTWKPSLPIPPRGRPVLHFDVPSVSNLSPRPSQDGGQDESTIKPMPLPVRPRQHAPPALGKSRHPAGASVKKDVRPKPYVLEVPTIAPHYPPNGHADFFPWTGNHTEDQFSEHVIRHGYLDKAQMTQNETASARSSIFPALKHKSGLQTLSSLLTNVLAQRRAHGQITSASTFKPPPRVTVTDTKREMWLKDLANPTISLRRLSRSIPHGIRGKVLLDQSLSKNIPIERAVWLAKCVGANELRSFRRKGASGTFAMGGEAKWIRDFTVCVEQFIESIAGTCGEKDFRVRIDYAIRLATHFHAEHLLDRDHYMDWLVSSVENSPQAKLPMWLLITEIYWKDILQYRKYGRRLATALMNQLTETLNHPDHDILAPLSDRLVVLLDGMMVSNPESFIAPKSWLKYRDALMSSLSGKSNSLSTVLLEIDRRNNRLAASSAKKELNSRRRFIKLLDRTLSHPFSHELARQWWQTDEDKDMLMQTVLEWASSFHRPGVAKIYVATRLLRTWSHFGADVTAAILHFIDSATYESGRNRNALYHLVSELARSEHFSTPRYLQWLIARGGLHDEADVVPSAPCSTRLLAELPTHNLSEGILELRMTLLTRANFSVDEEEEQVREYMAIINVDLPGMQTHVDQDLDSIDIPPFAHRIPLISTASRTSKSELGLWLRQKVRIQMIQPTIPPLDDWDDCPMKRGTSAITASEFGTIRQYLELINDYSMLADVMMIVASSNDPEVLASCADTLDLHLETFAAIGALKGLFDNLISRLRTLSKETDSIPRGFLVSVAELAARLPEQELTAQHLAQDLLRSDRKTAADACSPVSDHMAIVETAEVDFTDEIEKVLASGNSMDQGTLDRLFHRIILRSEESWEKSPEQQRSCGLLLTRLRTFDSKHFDVLMAAWVTRLLQTKARPALTKVLSPLISFGCLILRDVVLSYNLLVDTPDNQGAALEMLALLMEPCLMPDIITKQEAYRLRLKQSHMLKDYPRETLLIIRKAFESCPSDDNSPQHLHATELQSLLDSSPMCEVLGTLVLADPDVFVQELVLPLLQCGMTKPTASINAVIDYMLVGRDGPNQVTTEVLLNSANDLSLPFCQIKLASVLREEDTVMQDGDAGRSERLDAFDKAIKSAVDNGNTAWASIVPLLDRSVAQHLQQRAEQQFLALFPSPKTLNVEHLPDIQDRVVQARNVLRIINTTACIGSTISSSAIPEYPSLGPDIVAACNGLWLVLSNSYPQELKDCIITHWLPMLLSFIILHESAFDTTKSGHESRAKTILSLVAIYLQLQVLDVDIEVANELMKQTFDLSLSLVDLLPEDMRQQCIRSLRDTVCSPSVSYMLSYCANPSEWLVMVQKERVPARSGASADSRPVEKEKLTPFSLRRWENLGEPTPNVGENDTSLSLTLFGARRG
Length1500
PositionKinase
OrganismPhialocephala scopiformis
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Helotiales> Mollisiaceae> Phialocephala.
Aromaticity0.06
Grand average of hydropathy-0.241
Instability index48.62
Isoelectric point6.35
Molecular weight167708.89
Publications









Function






Annotated function

Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.


Component of the srb8-11 complex. The srb8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The srb8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.



GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP06612
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     509.25|     171|     212|     650|     861|       1
---------------------------------------------------------------------------
  439-  606 (156.43/75.14)	..........................................................QYRKYgrrlaTALMN....QLTETLNHPDHDI.......LAPLSDRLVVLLDGMMVSNPES....FIapksWL..KYR....DALMSSLSGKSNSlstvllEIDRRNNRLAASsakkELNSRRRFIKLLDrtlshpfshelarqwwqtdeDKDMLMQTVLEWASSfHRPGV.AKIYVATRL.LRTWSHFGA
  650-  848 (258.48/212.69)	QWLIARgglhdeadvvpsapcstrLLAELPTHNLSEGilELRMTLLTRANFSVDEEEEQVREY.....MAIIN...VDLPGMQTHVDQDLDSID...IPPFAHRIPLISTASRTSKSEL....GL....WLrqKVRiqmiQPTIPPLDDWDDC......PMKRGTSAITAS....EFGTIRQYLELIN....................DYSMLADVMMIVASS.NDPEVlASCADTLDLhLETFAAIGA
  875-  976 (94.35/43.45)	LVSVAE..................LAARLPEQELTAQ..HLAQDLLRSDRKTAADACSPVSDH.....MAIVEtaeVDFTDEIEKVLASGNSMDqgtLDRLFHRIILRSEESWEKSPEQqrscGL....LL......................................................................................................................
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      61.76|      18|      42|     281|     298|       5
---------------------------------------------------------------------------
  281-  298 (33.26/23.32)	KREMWLKDL..ANPTISLRR
  324-  343 (28.50/18.79)	ERAVWLAKCvgANELRSFRR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     136.33|      34|      35|      81|     114|       6
---------------------------------------------------------------------------
   10-   47 (48.40/23.77)	GREPLQ.......................rsfsSSTTTFSRPSPHRT...LSQKFPSSSPTRRT
   48-  108 (43.29/20.43)	NDVLIDltvdadaagrhaprigtsrlrlevstdSKSALVESPAPTSD...STSTWKPSLPIPPR
  109-  146 (44.64/21.31)	GRPVLH.......................fdvpSVSNL..SPRPSQDggqDESTIKP.MPLPVR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     225.15|      69|     141|    1096|    1164|       9
---------------------------------------------------------------------------
 1096- 1164 (118.43/78.49)	DDNSPQHLHATELQSLLDSSPMCEVLGTLVLADPD..VFVQELVLPLLQCGM.TKPTASINAVIDYMLVGRD
 1238- 1309 (106.72/69.93)	DRSVAQHLQQRAEQQFLALFPSPKTLNVEHLPDIQdrVVQARNVLRIINTTAcIGSTISSSAIPEYPSLGPD
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP06612 with Med12 domain of Kingdom Fungi
Unable to open file!