Description | Mediator of RNA polymerase II transcription subunit 6 (Fragment) |
Sequence | VNLQHVQWRAPEFLLALPQGQLSSRQLALDYFALSPFFDKQSSNAQLRMQMLFSRAPADSWDEEGQLARFTGIEYAVARLESDPPDLWIVHKRRRSSPSETRVLAAYHILNGNVYLAPTVYHILSERLLTATHALATAFTALTDLKPRWTPQRQYAWDIKPPPAGVGPQPDAQDPPGPEEEQERPGETFNPLLFRALQTIATKTE |
Length | 205 |
Position | Head |
Organism | Rhodotorula sp. JG-1b |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina> Microbotryomycetes> Sporidiobolales> Sporidiobolaceae> Rhodotorula> unclassified Rhodotorula. |
Aromaticity | 0.10 |
Grand average of hydropathy | -0.457 |
Instability index | 76.63 |
Isoelectric point | 5.98 |
Molecular weight | 23199.93 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP06609 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 45.50| 14| 18| 23| 39| 1 --------------------------------------------------------------------------- 23- 36 (24.21/18.79) SSRQLALDY.FALSP 43- 57 (21.29/ 6.94) SNAQLRMQMlFSRAP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) PEEEQERPGETFNPLLFRALQTIA 2) RQYAWDIKP | 178 153 | 201 161 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab