<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06606
Description |
Mediator of RNA polymerase II transcription subunit 7 (Fragment) |
Sequence | MATATYPPPPPYYRLYKDYEQNPSSAPEPPPPIEGTYLLYGANYTTDDVLPTLEDQGVRQLYPKGSNVDFKKELRSLNRELQLHILELADVLIERPSQYARRVEDISLIFKNLHHLLNSLRPHQ |
Length | 124 |
Position | Middle |
Organism | Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Carduoideae> Cardueae>
Carduinae> Cynara.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.681 |
Instability index | 63.19 |
Isoelectric point | 5.76 |
Molecular weight | 14361.07 |
Publications | PubMed=26786968
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP06606
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.75| 13| 23| 31| 43| 2
---------------------------------------------------------------------------
31- 43 (26.21/14.38) PPIE..GTYLLY..GAN
51- 67 (15.54/ 6.31) PTLEdqGVRQLYpkGSN
---------------------------------------------------------------------------
|