<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06601
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSDRASSASFRVGPPSPSSPAAGALKQNQLPAPLSDRIPQTPTSPPLMSVSAQNYATNFVSSQASPNQATSQSATLSSPPSSAPMSTQASQQPTVGTANSFPTPASSVSGHFPGATSFDDSEHTDKPMGSAVPDTGAQAANMNAAAIQQAEHRRTDHDRHTEGINMEVGVRDFAANNGGDAMDIDSEAPASSSRSEPSLESLQKNFSSAFHVCKSSHIATGPDPSLDLISLYGLGPVAKSVARMDPVTGEKINRLRKSYEGKLKGLGLAGRNKPVKNEPGAPGSLRHMTMWPEEEWQNQKVFGKEIKVADMDSALQNLQMRAMKMEPGTVPNNEYWEDVLGHEKPSKHAGGDASKKGVAPPPNGVRISQPNGTPAPVSDQERARPSRGRKRHYDDNSFVGYGEGYADDDDDGAFYSNSEGMGKKKRKKVGRSDGEMAF |
| Length | 438 |
| Position | Head |
| Organism | Aspergillus niger |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Circumdati.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.797 |
| Instability index | 52.97 |
| Isoelectric point | 6.43 |
| Molecular weight | 46516.78 |
| Publications | PubMed=26893421
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP06601
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 144.21| 45| 171| 104| 197| 1
---------------------------------------------------------------------------
42- 92 (68.11/11.49) PTSpplmSVSAQ.NYATNFVSSQASPNQAtsQSATLSSPPSSAPMSTQASQQ
104- 149 (76.10/63.49) PAS....SVSGHfPGATSFDDSEHTDKPM..GSAVPDTGAQAANMNAAAIQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.67| 20| 170| 178| 197| 2
---------------------------------------------------------------------------
178- 197 (36.08/16.55) GGDAMDIDSEAPASSSR.SEP
350- 370 (33.59/14.94) GGDASKKGVAPPPNGVRiSQP
---------------------------------------------------------------------------
|