Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSDRASSASFRVGPPSPSSPAAGALKQNQLPAPLSDRIPQTPTSPPLMSVSAQNYATNFVSSQASPNQATSQSATLSSPPSSAPMSTQASQQPTVGTANSFPTPASSVSGHFPGATSFDDSEHTDKPMGSAVPDTGAQAANMNAAAIQQAEHRRTDHDRHTEGINMEVGVRDFAANNGGDAMDIDSEAPASSSRSEPSLESLQKNFSSAFHVCKSSHIATGPDPSLDLISLYGLGPVAKSVARMDPVTGEKINRLRKSYEGKLKGLGLAGRNKPVKNEPGAPGSLRHMTMWPEEEWQNQKVFGKEIKVADMDSALQNLQMRAMKMEPGTVPNNEYWEDVLGHEKPSKHAGGDASKKGVAPPPNGVRISQPNGTPAPVSDQERARPSRGRKRHYDDNSFVGYGEGYADDDDDGAFYSNSEGMGKKKRKKVGRSDGEMAF |
Length | 438 |
Position | Head |
Organism | Aspergillus niger |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus> Aspergillus subgen. Circumdati. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.797 |
Instability index | 52.97 |
Isoelectric point | 6.43 |
Molecular weight | 46516.78 |
Publications | PubMed=26893421 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP06601 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 144.21| 45| 171| 104| 197| 1 --------------------------------------------------------------------------- 42- 92 (68.11/11.49) PTSpplmSVSAQ.NYATNFVSSQASPNQAtsQSATLSSPPSSAPMSTQASQQ 104- 149 (76.10/63.49) PAS....SVSGHfPGATSFDDSEHTDKPM..GSAVPDTGAQAANMNAAAIQQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 69.67| 20| 170| 178| 197| 2 --------------------------------------------------------------------------- 178- 197 (36.08/16.55) GGDAMDIDSEAPASSSR.SEP 350- 370 (33.59/14.94) GGDASKKGVAPPPNGVRiSQP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DDGAFYSNSEGMGKKKRKKVGRSDGEMAF 2) HYDDNSFVGYGEGYADD | 410 392 | 438 408 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab