<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06596
Description |
Mediator of RNA polymerase II transcription subunit 1 |
Sequence | MSDTYFDALNLMINRFLEYKPGSITLENITRLCQAMGLESFVDQVNSNISRLSIASKIIVIDIDYETTDGRVTDVKLVLASNFDRFDYFNGEENILYRSLTNYSELHEFHYNLRFLTLLDAYSNIEIESNISQFDLFEYYSVLPRYVQQYLNDNGVKLKVRTNLNDRFGIYLVDEEGTAVAKLIFGPTLDPAQRYYEYKYSSKTKEWFNESPESYASGVTLLVELLGKEKTYFARDCIPLEQLQTSHENDMDPESPEPFAFKANNRRIHLSNDFTIDLYPVSSLQLFNDNVSLLFDILKWYNWWHKVLHPISEILLEGENEMQGGSSLPQVQPPSSASHCRRPSVKGHRRPSVNDPSVLKDENLAQFTLNDILNSSTIEEDDEMVDDEAVDLFVNEDYVYLGMSDRCSYYDDSEEEWVNFITKLKQLT |
Length | 428 |
Position | Middle |
Organism | Eremothecium sinecaudum |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Eremothecium.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.430 |
Instability index | 46.57 |
Isoelectric point | 4.52 |
Molecular weight | 49689.87 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364059
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP06596
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 128.40| 39| 43| 202| 244| 1
---------------------------------------------------------------------------
202- 244 (62.81/55.39) SKTKEWFNESPESYA.SGVTLLVELlgkeKTYFARDCIPLEQLQ
246- 285 (65.60/47.26) SHENDMDPESPEPFAfKANNRRIHL....SNDFTIDLYPVSSLQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.28| 24| 44| 95| 120| 3
---------------------------------------------------------------------------
95- 120 (36.24/31.64) ILYRSLTNYseLHEFHYNLRFLTLLD
142- 165 (38.04/26.02) VLPRYVQQY..LNDNGVKLKVRTNLN
---------------------------------------------------------------------------
|