<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06593

Description "Protein kinase, catalytic domain-containing protein"
SequenceMGSEVEVIEDRVEEFNDVENTIFVAVGKNVKESKSLISCALQCFARMKICLLHIHQPGQLVTLLDDKFSASRVKDQVVKACRERDRQKMHKILNEYNLILDQAGVFFILLILKVKAGKVWIEAGKVETGIVQTIVQHGIRWLVMGAAAEKLYSKESSGGARLHTRSIKALPSSETALTLYHEADASMEVSSLQCLEKATSAKNGTSDSLLVLAIDADEEVNSARCLENSMVSTKNVYGTSTSTSLLINYARGNGSTLPASYESQDQLVQSCSAMFLEGPQGLSSSDLLDKLEYATTEAENSKQKAFEESIRRWKAEEDAKEAIHKAEASEKLCMEEITQIKEMEATLVKQNRELETMKNQQDEFKKELQMVRDQKPGLVDRISKARDAEKELEEKIIQAVNLLITFKERRDNLQDELDNARRQINGLANYDETTNVSQIQFYKPSFLEIMEATQDLNQSLKIGEGRCGSVYKGILRHVRVAIKMLPSLGSQGEAEFEREAEVLSRMRHPNLVMLIGVCTETRSLIYEYLENGSLEDRIASRSTTPPLPWQTRIRISSEICSALIFLHGSKPHILHGNLMLTNVLLDSNYVSKLSDLGINRLIFCKDQTSSTSFYHNVEPEVSAYMDPELLKSGKLAASSDIYSFGVVLLRILTGRPASSVVNDTRCALENGNFGTILDSSAGNWPIEDATQLAYLGLRCCENDPMNRPDLVNDIWTEVMEDPYIAADGFTYEADAIKGWLNSGHKTSPMTNLKLDHCDLLPNHALSYAIQEWQQQHS
Length777
PositionTail
OrganismCynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> campanulids> Asterales> Asteraceae> Carduoideae> Cardueae> Carduinae> Cynara.
Aromaticity0.06
Grand average of hydropathy-0.329
Instability index41.86
Isoelectric point5.30
Molecular weight86943.81
Publications
PubMed=26786968

Function

Annotated function Functions as an E3 ubiquitin ligase. 
GO - Cellular Component
plasma membrane	GO:0005886	IEA:EnsemblPlants

GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro
ubiquitin-protein transferase activity	GO:0004842	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP06593
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      83.14|      26|      28|     170|     196|       1
---------------------------------------------------------------------------
  170-  196 (40.11/32.25)	LPSSETALtLYHEADASMEVSSLQCLE
  202-  227 (43.03/29.53)	KNGTSDSL.LVLAIDADEEVNSARCLE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      61.54|      18|     287|     271|     288|       2
---------------------------------------------------------------------------
  271-  288 (34.26/21.24)	CSAM.FLEG..PQGLSSSDLL
  560-  580 (27.27/15.50)	CSALiFLHGskPHILHGNLML
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     126.11|      38|      46|     341|     378|       3
---------------------------------------------------------------------------
  341-  378 (64.39/46.04)	KEMEATLVKQNRELETMKNQQDEFKKELQMVRDQKPGL
  390-  427 (61.72/43.83)	KELEEKIIQAVNLLITFKERRDNLQDELDNARRQINGL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.26|      15|      26|     294|     308|       4
---------------------------------------------------------------------------
  294-  308 (24.41/15.93)	ATTEAENSKQKAFEE
  322-  336 (25.85/17.29)	AIHKAEASEKLCMEE
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP06593 with Med32 domain of Kingdom Viridiplantae
Unable to open file!