<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06589
Description |
"Mediator complex, subunit Med22" |
Sequence | MNKGGAGGGTSGAGGPTAAAAAAAAQKQKSLQQRVDNDIGSIVDNFSIVVNVARVQAADSLLKLVSELKQTAIFSGFASLNDHVEQRSEELNKQAEKTDRILGSIGEDAAASLKEMESHYYSSVVRSNQHLQQ |
Length | 133 |
Position | Head |
Organism | Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Carduoideae> Cardueae>
Carduinae> Cynara.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.370 |
Instability index | 43.09 |
Isoelectric point | 5.88 |
Molecular weight | 13957.28 |
Publications | PubMed=26786968
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP06589
No repeats found
|