<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06587
| Description |
"Transcription elongation factor, TFIIS/CRSP70, N-terminal, sub-type" |
| Sequence | MAALESGGRMDYWREYFQTSNGDLFETIEKAIMVAASDYPKEFRIRRDGIAQILFSCNLIKCCGCDKLELGFPADDEQEDDDDDDHKELNDNIINKVSDYDYGVAEALTDEIEEESQMFGEVMRIKQIVDNHQDESESVLYNSLRKLQLMALSVEILKATEIGKSINVLRKHVSKDVRHIAKTLIGGWKYMVDQWVMATEKAAAVSEATPESLNPSVLDEEEEGLPSPPLDDLAFFYPQTSLELSEFFDGMDEYGSELNNPGNNGRTEKQSIPKCKQQKPTNVPIMVRKNEPDSDVMKMKKKQATVVKPIKPSVAESAPGRPKKQRKIQVMELHDLPKPKQQQGFPIRNQHNVRLGSNHNRHR |
| Length | 363 |
| Position | Unknown |
| Organism | Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Carduoideae> Cardueae>
Carduinae> Cynara.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.722 |
| Instability index | 55.04 |
| Isoelectric point | 5.14 |
| Molecular weight | 41274.17 |
| Publications | PubMed=26786968
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | translation elongation factor activity GO:0003746 IEA:UniProtKB-KW
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP06587
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.25| 15| 15| 321| 335| 1
---------------------------------------------------------------------------
321- 335 (26.06/17.24) RPKKQRKIQVMELHD
338- 352 (28.19/19.20) KPKQQQGFPIRNQHN
---------------------------------------------------------------------------
|