<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06576
Description |
Uncharacterized protein |
Sequence | MQLRVMEHSFGSTGGLYDENNFSAAIAALTLAFSRGCGVDFNTDDILMVALGQLSPGECSEDLRIDIIKTADNLQRGSNHIH |
Length | 82 |
Position | Tail |
Organism | Penicillium freii |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.051 |
Instability index | 36.36 |
Isoelectric point | 4.63 |
Molecular weight | 8870.84 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP06576
No repeats found
No repeats found
|