<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06576
| Description |
Uncharacterized protein |
| Sequence | MQLRVMEHSFGSTGGLYDENNFSAAIAALTLAFSRGCGVDFNTDDILMVALGQLSPGECSEDLRIDIIKTADNLQRGSNHIH |
| Length | 82 |
| Position | Tail |
| Organism | Penicillium freii |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.051 |
| Instability index | 36.36 |
| Isoelectric point | 4.63 |
| Molecular weight | 8870.84 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP06576
No repeats found
No repeats found
|