<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06571
Description |
Unnamed protein product |
Sequence | MADILTQLQTCLDQLATQFYATLCYLTTYHDNIPATPPPTSTTPSAAPLLAKIPKNASTPPVPASAPQAAQSQSQASPPPPDSTNPPGQGQNADNQQQQNADGTAEGLPAPDSPATFAARQRELARDLVIKEQQIEYLISVLPGIDSSEAEQERRIRELEGELRVVEGVREERRRELGALRRRLEGVLGVVERGIYSRG |
Length | 199 |
Position | Middle |
Organism | Aspergillus niger |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Circumdati.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.598 |
Instability index | 75.73 |
Isoelectric point | 4.93 |
Molecular weight | 21545.77 |
Publications | PubMed=26893421
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP06571
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.92| 17| 17| 44| 60| 1
---------------------------------------------------------------------------
44- 60 (31.40/20.49) PSAAPLLAKIPKNASTP
63- 79 (30.52/19.69) PASAPQAAQSQSQASPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 99.78| 32| 32| 97| 128| 2
---------------------------------------------------------------------------
97- 128 (54.37/27.32) QQQNADGTAEGLPAPDSPATFAARQ.RELARDL
131- 163 (45.42/21.78) KEQQIEYLISVLPGIDSSEAEQERRiRELEGEL
---------------------------------------------------------------------------
|