<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06560
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MATPPPPPPPPAAPAPAPAPAPAADTDPSAPPRVQVEHTLEQLLQTLLEMGICASDVQESALETSVGGVASGQPGGLLGRKAQQTVEQLARLYSQKDLVNDINVPIEVINLVDQGKNPHLHTKNFIERLAGENMYTNGILSGITDYRDLLRAQLGEAFPDLAEDVKLMTPAPAAASDPVGTSSAAGDALHAGGPTMNGINSTHDVKMEDAR |
| Length | 211 |
| Position | Middle |
| Organism | Rhodotorula sp. JG-1b |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina>
Microbotryomycetes> Sporidiobolales> Sporidiobolaceae> Rhodotorula>
unclassified Rhodotorula.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.278 |
| Instability index | 43.36 |
| Isoelectric point | 4.59 |
| Molecular weight | 21970.46 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP06560
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.25| 20| 149| 9| 28| 1
---------------------------------------------------------------------------
9- 28 (40.33/15.94) PPPAAPAPAPAPAPAADTDP
159- 178 (36.92/14.07) PDLAEDVKLMTPAPAAASDP
---------------------------------------------------------------------------
|