<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06555
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MSDNAAATTAPAPATQAPTPAERDANRIRFETELEFVQCLANPFYLQSLAQQGLFDQPTFLNYLRYLLYFRDPRYARFLQYPSSLEHLSLLTAPDPSGQSFRNAWREQPLMAQEWAGKMVARWAEWRERETLGGEGEGGGLEAGSGAGGGGKANGAAP |
| Length | 158 |
| Position | Middle |
| Organism | Rhodotorula sp. JG-1b |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina>
Microbotryomycetes> Sporidiobolales> Sporidiobolaceae> Rhodotorula>
unclassified Rhodotorula.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.528 |
| Instability index | 52.77 |
| Isoelectric point | 5.05 |
| Molecular weight | 17357.10 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP06555
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.79| 17| 18| 98| 114| 1
---------------------------------------------------------------------------
98- 114 (33.00/19.90) GQSF.RNA.WREQPLMAQE
117- 135 (24.79/13.42) GKMVaRWAeWRERETLGGE
---------------------------------------------------------------------------
|