Description | Uncharacterized protein (Fragment) |
Sequence | EHHEAISTPDSGFYPSKFFSHIAYCCSTTRPAHVASKQDALNNAYQEFVGAVASTLEAKEASGGQVTVATDAALENLKQKWELFRVACDQAEEFVESVKLRIGSECLVDEATGSVAGKPGQSVTPGLPPISAVRLEQMSKAVRWLVIELQQGSGSAGNLSMPQHSSAPFDARFHEDSAQ |
Length | 179 |
Position | Tail |
Organism | Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> campanulids> Asterales> Asteraceae> Carduoideae> Cardueae> Carduinae> Cynara. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.273 |
Instability index | 56.36 |
Isoelectric point | 5.18 |
Molecular weight | 19181.12 |
Publications | PubMed=26786968 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | |
GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro leaf senescence GO:0010150 IEA:InterPro regulation of transcription, DNA-templated GO:0006355 IEA:InterPro root development GO:0048364 IEA:InterPro |
Binary Interactions |
Repeats | >MDP06548 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) RWLVIEL 2) SSAPFDARFHEDSAQ | 143 165 | 149 179 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab