| Description | Uncharacterized protein (Fragment) |
| Sequence | EHHEAISTPDSGFYPSKFFSHIAYCCSTTRPAHVASKQDALNNAYQEFVGAVASTLEAKEASGGQVTVATDAALENLKQKWELFRVACDQAEEFVESVKLRIGSECLVDEATGSVAGKPGQSVTPGLPPISAVRLEQMSKAVRWLVIELQQGSGSAGNLSMPQHSSAPFDARFHEDSAQ |
| Length | 179 |
| Position | Tail |
| Organism | Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> campanulids> Asterales> Asteraceae> Carduoideae> Cardueae> Carduinae> Cynara. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.273 |
| Instability index | 56.36 |
| Isoelectric point | 5.18 |
| Molecular weight | 19181.12 |
| Publications | PubMed=26786968 |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | |
| GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro leaf senescence GO:0010150 IEA:InterPro regulation of transcription, DNA-templated GO:0006355 IEA:InterPro root development GO:0048364 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP06548 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) RWLVIEL 2) SSAPFDARFHEDSAQ | 143 165 | 149 179 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab