Description | Mediator of RNA polymerase II transcription subunit 9 |
Sequence | MNKKRMVNDKKAIRRTDASLGELDGARPGDEIRENREGNLGKLSNLNDMEGGALVENLADAIENGTRDQHFDTLVTELSSHFEKCQQLLNTISGSIATKAATVEGQKRKVEEAEQMLNQRRDLIAKYRYSVEELTKPDL |
Length | 139 |
Position | Middle |
Organism | Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> campanulids> Asterales> Asteraceae> Carduoideae> Cardueae> Carduinae> Cynara. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.853 |
Instability index | 27.66 |
Isoelectric point | 5.51 |
Molecular weight | 15602.31 |
Publications | PubMed=26786968 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364145 |
GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblPlants |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP06545 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) IRENREGNLGKLSNL 2) LVENLADAI 3) MNKKRMVNDKKAIRRTD 4) RRDLIAKYRYS 5) TKPDL | 32 54 1 120 135 | 46 62 17 130 139 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab