| Description | Uncharacterized protein |
| Sequence | MDSIVDALDNAYQEFVGAVASTLEAKEASGGQVTVATDAALENLKQRWELFRVACDQAEEFLESVKLRIASECLVDEATGSVAGKPVTPGLPPISAVRLEQMSKAVRWLVIELQQGSGAGNLSTPNHSSAPFDARFHEDSTQ |
| Length | 142 |
| Position | Tail |
| Organism | Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> campanulids> Asterales> Asteraceae> Carduoideae> Cardueae> Carduinae> Cynara. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.148 |
| Instability index | 51.81 |
| Isoelectric point | 4.52 |
| Molecular weight | 15189.78 |
| Publications | PubMed=26786968 |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | |
| GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro leaf senescence GO:0010150 IEA:InterPro regulation of transcription, DNA-templated GO:0006355 IEA:InterPro root development GO:0048364 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP06544
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.32| 10| 34| 80| 89| 1
---------------------------------------------------------------------------
80- 89 (19.70/14.52) GSVAGKPVTP
116- 125 (19.62/14.44) GSGAGNLSTP
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) FDARFHED 2) ISAVRLEQMS | 132 94 | 139 103 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab