Description | Uncharacterized protein |
Sequence | MDSIVDALDNAYQEFVGAVASTLEAKEASGGQVTVATDAALENLKQRWELFRVACDQAEEFLESVKLRIASECLVDEATGSVAGKPVTPGLPPISAVRLEQMSKAVRWLVIELQQGSGAGNLSTPNHSSAPFDARFHEDSTQ |
Length | 142 |
Position | Tail |
Organism | Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> campanulids> Asterales> Asteraceae> Carduoideae> Cardueae> Carduinae> Cynara. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.148 |
Instability index | 51.81 |
Isoelectric point | 4.52 |
Molecular weight | 15189.78 |
Publications | PubMed=26786968 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | |
GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro leaf senescence GO:0010150 IEA:InterPro regulation of transcription, DNA-templated GO:0006355 IEA:InterPro root development GO:0048364 IEA:InterPro |
Binary Interactions |
Repeats | >MDP06544 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 39.32| 10| 34| 80| 89| 1 --------------------------------------------------------------------------- 80- 89 (19.70/14.52) GSVAGKPVTP 116- 125 (19.62/14.44) GSGAGNLSTP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FDARFHED 2) ISAVRLEQMS | 132 94 | 139 103 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab