<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06539
Description |
Uncharacterized protein |
Sequence | MDSCSQDGHSSSPYDDLMLHSHSSKKIVFPRQALIAPHALIDFPPKTLAIHASNMARVPIEVKSISPKSLSASVSDIGSVVSMIDNIAGSAPGNGSRTAVGEDLVAMTKLHLQARTSGIPDGTRKIKRFTSAIPLNGVSSVNSVNDNFKHFNFVEASVYM |
Length | 160 |
Position | Tail |
Organism | Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Carduoideae> Cardueae>
Carduinae> Cynara.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.077 |
Instability index | 38.87 |
Isoelectric point | 8.79 |
Molecular weight | 17045.22 |
Publications | PubMed=26786968
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP06539
No repeats found
|