<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06535
Description |
"Transcription elongation factor, TFIIS/CRSP70, N-terminal, sub-type" |
Sequence | MEELKMDATYSCHLINSMKQDDASIYTSLGEPEIKQETKIVAEVLKIKQILDKTPYESQSVAAVVYESLSKLQHLGLSFKTLEATGIGKSVGALQKHASRDVRQIAKKLVRIWKGVVDEWFNATENMSTSKGGEEWNMINPAPIKKQTSTVRKKKHSANKFQLSEREEESKEIMRMEEKLEATKRKLLQGYQEAENKKRQRRIQVIDLHELTQEHLLPQTQHRVTKYRNLP |
Length | 231 |
Position | Unknown |
Organism | Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Carduoideae> Cardueae>
Carduinae> Cynara.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.787 |
Instability index | 46.25 |
Isoelectric point | 9.36 |
Molecular weight | 26674.33 |
Publications | PubMed=26786968
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | translation elongation factor activity GO:0003746 IEA:UniProtKB-KW
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP06535
No repeats found
No repeats found
|