<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06531
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MYIRVLHWQPNAGHTVSSQILAEVSQCVESINGVKEGKWKATLSFYRPVLKEQANAAEFPRDFLGISLPEQPSKYYFVLRGQRLVLEADSTIQTIMEKLQSYKTRVALNFEGFQYQLGDFQLRVGKVVSIQSESLRGIVMEMEYRPISSWEKSHKIMGEFFDIWQEALSKRSLPGHFVHMEPNFGEFGLSGQYTLQHTAVQYATIMLQMIATAQSVRN |
Length | 218 |
Position | Head |
Organism | Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Carduoideae> Cardueae>
Carduinae> Cynara.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.237 |
Instability index | 39.37 |
Isoelectric point | 7.85 |
Molecular weight | 25018.41 |
Publications | PubMed=26786968
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP06531
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 109.61| 37| 41| 80| 120| 1
---------------------------------------------------------------------------
80- 120 (49.39/45.82) RGQRLV.LEADSTIQTIMEkLQsYktRVALNFEGFQYQLGDF
123- 160 (60.22/38.89) RVGKVVsIQSESLRGIVME.ME.Y..RPISSWEKSHKIMGEF
---------------------------------------------------------------------------
|