<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06530
| Description |
Uncharacterized protein |
| Sequence | MRYDKNCPPVRSKPLVLTRAPLIRAGEASKIYNGDVMETIPTPKPTKILPTIMTHGFRTRAMTNDPVMNKISANNIDFFLPNLSFIHPPKAPPMIAPATAMLTMVTLREEIQSACEYRPFEKCDYIVRTSNETCCKFSRNR |
| Length | 141 |
| Position | Head |
| Organism | Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Carduoideae> Cardueae>
Carduinae> Cynara.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.334 |
| Instability index | 43.32 |
| Isoelectric point | 9.51 |
| Molecular weight | 16003.64 |
| Publications | PubMed=26786968
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP06530
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.93| 18| 29| 33| 50| 1
---------------------------------------------------------------------------
33- 50 (33.16/17.93) NGDVMETIPTPKPTKILP
64- 81 (32.77/17.65) NDPVMNKISANNIDFFLP
---------------------------------------------------------------------------
|