Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MESTGAAASGGNGTLNPQHNDASPAESTVMATTSSSDDPKQNLNQVINSIQKSLGIIHQLYLTVSSFNVSSQLPLLQRLNTLVLEMDNMTKLSEKCNIQVPMEVLNLIDDGKNPDEFTREVLNSCIAKNQITKGKTDAFKGLRRHLLEELEQAFPDEVEDYREIRASSAAESVRLAQAQSILPNGDEWHFNEKQNTQKQE |
Length | 200 |
Position | Middle |
Organism | Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> campanulids> Asterales> Asteraceae> Carduoideae> Cardueae> Carduinae> Cynara. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.601 |
Instability index | 41.30 |
Isoelectric point | 4.89 |
Molecular weight | 22155.43 |
Publications | PubMed=26786968 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP06519 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) EDYREIRA 2) RRHLL 3) WHFNEK | 159 143 188 | 166 147 193 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab