Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MAATPMLPPNLAPGNANFDGNAAAAPPTPGTDMTGICFRDQLWLNTYPLDRNLVFDYFALSPFYDYTCNNEQLRMRSIHPLDISHLSKMTGIEFMVSEVMEPHLFVMRKQKRDGPEKVTPMLTYYVLDGSIYQGPQLCNVFAARVVLDSENEGVSLEPKAAKESIDFKEVKRVDHILASLQRKLPPAPQPPPFPEGYAPPTTTEGEQAPEAEQADPKLPLVDPILDQGPSKRLKYT |
Length | 236 |
Position | Head |
Organism | Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> campanulids> Asterales> Asteraceae> Carduoideae> Cardueae> Carduinae> Cynara. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.409 |
Instability index | 53.27 |
Isoelectric point | 5.05 |
Molecular weight | 26288.76 |
Publications | PubMed=26786968 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP06509 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 52.45| 15| 17| 102| 116| 2 --------------------------------------------------------------------------- 102- 116 (28.65/21.54) PHL..FVMRKQKRDGPE 120- 136 (23.79/16.65) PMLtyYVLDGSIYQGPQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EVKRVDHILASLQRKL 2) FPEGYAPPTTTEGEQAPEAEQADPKLPLVDPILDQGPSKRLKYT | 169 193 | 184 236 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab