<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06499
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSDRTHPTSFQARPPSPSSPAGSLKENPRLPISSEHIPQTPTSPPLMSVNEQSHAANFTSSHTSPNQATVQPPNISSPPSSAPMSTQVSQQPTMSTTNSFPTPASSVSSHPANATSEDVDQGRKPFNMGIQVSAENSGAAPAQQQTKQPTQHRPTDHDRQTLQTESTNDFATGQGQHSTDPDAMDVDTEPTRRADTLSLDLDSLQKELTSAFHLCKSSPIVTGPDPSVDLVSLYGLGSIAHSVARMDPVTGEKINRLRKSYEGKLKGLGLAGRNKPHKQEIGAPGSLRHMTLWPEEEWQNQKVHGKAIKVSDMDSALQNLQSRAMQMEPGPIPNNDWWEDILGHEKQAKNPAPGETGKKAAPAPTAGRPSMQSYAASPRSQEAERPRPSRGRKRNYDDNSFAGYGEGFVDDDDDPGFYSNGEGTGKKKRKKDHVAKVSTPMSERSASYGVGMFGIGAR |
| Length | 458 |
| Position | Head |
| Organism | Penicillium freii |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.950 |
| Instability index | 55.56 |
| Isoelectric point | 6.74 |
| Molecular weight | 49393.82 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP06499
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 107.21| 25| 27| 14| 39| 1
---------------------------------------------------------------------------
14- 37 (32.88/17.40) .......PP....SP..........SSPAGSLKENPrLPISSEHI
38- 63 (23.27/ 7.23) P.QtptsPPlmsvNE..........QSHAANF........TSSHT
65- 88 (28.28/10.44) PnQatvqPP....NI..........SSPPSS......APMSTQ.V
120- 153 (22.78/ 6.92) D.Q.grkPF....NMgiqvsaensgAAPAQQQTKQP.....TQHR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.83| 11| 15| 397| 407| 2
---------------------------------------------------------------------------
397- 407 (22.39/11.07) DDNSFAGYGEG
413- 423 (23.44/11.87) DDPGFYSNGEG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.27| 17| 21| 352| 368| 3
---------------------------------------------------------------------------
352- 368 (29.78/14.69) APGETGKKAAPAPTAGR
376- 392 (30.49/15.22) ASPRSQEAERPRPSRGR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 108.87| 25| 26| 198| 223| 4
---------------------------------------------------------------------------
158- 180 (31.66/24.25) ..DRQTLQTESTNDFATGQGQH.STD
198- 223 (37.82/36.96) SLDLDSLQKELTSAFHLCKSSPiVTG
227- 251 (39.39/32.31) SVDLVSLYGLGSIAHSVARMDP.VTG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.28| 20| 21| 263| 282| 5
---------------------------------------------------------------------------
263- 282 (34.29/22.68) GKLKGLGLAGRNKPHKQEI.G
285- 305 (34.00/22.43) GSLRHMTLWPEEEWQNQKVhG
---------------------------------------------------------------------------
|