<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06495
| Description |
Uncharacterized protein |
| Sequence | MADILTQLQTCLDQLATQFYATLGYLTTYHDNAPTTPPPNVPDAAPALAKITKNSSSPPVPAAIANKVGGAAAVAGNASPPHAPPQQPGAAPGTAVEGGDPNLPPAPDSPSTFASRQRELARDLIIKEQQIEYLISVLPGIGASEAEQETRIRELETELRGVEKERAAKVRELKKLRTRLEDVLGAVAVGIHGDGYPQK |
| Length | 199 |
| Position | Middle |
| Organism | Penicillium freii |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.365 |
| Instability index | 56.54 |
| Isoelectric point | 5.43 |
| Molecular weight | 20938.38 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP06495
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 94.47| 19| 20| 70| 88| 1
---------------------------------------------------------------------------
47- 65 (26.60/ 9.53) ALAKITKNSSSPPVPAAIA
70- 88 (36.49/15.42) GAAAVAGNASPPHAPPQQP
93- 110 (31.38/12.38) GTAVEGGDPNLPPA.PDSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 55.13| 14| 15| 147| 160| 2
---------------------------------------------------------------------------
127- 139 (13.72/ 6.75) .KEQQIEYLISVLP
147- 160 (22.64/14.71) EQETRIRELETELR
165- 177 (18.77/11.25) ERAAKVRELK.KLR
---------------------------------------------------------------------------
|