<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06489

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMDNANIGGLRHGTGNTYPQDGLSHPRGEVVQFNGANAQDGPVHVNGVEKNASQSRSVETVSANHALRVTKGPPELPHITQGFFPFTKLVNRSVQQCWNDLSDLITEMAEMQVNSHEFHPSTAPTTGKSPGNQSPGNIRKKLRILEFSHAKRAEFIKLLVLSQWSRQAADVSKLIDIQNFIRTRHQAYMNALQWVGDMKRDLVQAQVANPDLKTALEVLSRGKVASMSDLGYKPPRRLTVRGTLKKLQKINRLIGARLVVQEEIPPPFRNYRVHDGRVTFGVPGEFELDLSIGEENENSQFFFVDIRFLFSPSPPILKGRLLNELEMTINDVLQNSGLTGCFDLLHNLVLTNKVNILFKQATEMARGPWSECLRVELLHRTLVVQYWTLKPGAKSWLEIGIRSGHRKSDSESPGLPSLKFRWMRDGGEVPCEDIAFDAENLSMEIVLRSVIALHVSHILSSAYNKIRQSSLFSTGFLSLRAHLTRTEPGDCQLDAQLTETRHLRVSIEPMSGMSIFSATPTVSDRSDLERNPERSSVEDIVSRVARIRCNAAIEEIESKVKMLGFEPLNPRAWKVDIRRIFPPNVLRFTLFSHQLWGRNWIVAATSSMDSDSWWVVQLRPTAPAKGPPVPHGSGRGQSVLRSAQVVTDSFFPARYDIDDAYLANLGHSLSGILAIHSNARYLSDLQSIKFHPPPHKLKIEPDLRVPDILVRYDVSTLPSVFRAAMPVKAKKKSLIRDTIRLAFHGVDPREKCAIMVAYGNLVDSTATLGPLISSWDRSLVFQKGGSGFAMRLLAPAGHPVIASLLENLQRLECVLSVLESLQRKKVEIRTFSLSSISFVYGPERDLAASLNIHLSRNESLMELSPTELASRSESLFGLRLGIQFGLQNPHRRIQDSLASSLNRSSTEAGLETVVELLTLTLPLMRALDQLMANPSYSGPLRLHVTVRNAKTYQIHYPGDEARFQLVAASHQNRLVWVLKDANSQGNSKNNDSITARLRQTLYTSKGDGWKGLETGVVAEVNQVGNLLRELENCFVASRADPAVSGSNNPGTSALETEKGTADGAKISLSDPFTTMPNDKSSLSQADTAAQKEDIIMID
Length1097
PositionTail
OrganismAspergillus niger
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus> Aspergillus subgen. Circumdati.
Aromaticity0.07
Grand average of hydropathy-0.277
Instability index47.94
Isoelectric point9.09
Molecular weight121829.58
Publications
PubMed=26893421

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	ARBA:ARBA00003669
ECO:0000256	RuleBase:RU365082
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP06489
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      80.22|      29|      34|     858|     891|       1
---------------------------------------------------------------------------
  858-  891 (40.95/46.17)	SLmelsPTELaSRSESLFGLRLGIQ.FGLQNPHRR
  895-  924 (39.28/27.40)	SL....ASSL.NRSSTEAGLETVVElLTLTLPLMR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.66|      19|      34|     679|     697|       2
---------------------------------------------------------------------------
  679-  697 (36.19/23.29)	RY.LSDLQSIKFHPPPHKLK
  710-  729 (26.46/15.00)	RYdVSTLPSVFRAAMPVKAK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.36|      13|      34|     286|     298|       3
---------------------------------------------------------------------------
  286-  298 (21.46/15.50)	ELDLSIGEENENS
  323-  335 (21.90/15.98)	ELEMTINDVLQNS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      80.31|      25|      30|     136|     163|       4
---------------------------------------------------------------------------
  136-  163 (36.40/36.61)	NIRKKLRILEFSHAKRAEFIKLLvlsQW
  169-  193 (43.91/34.33)	DVSKLIDIQNFIRTRHQAYMNAL...QW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.65|      18|      42|     469|     487|       5
---------------------------------------------------------------------------
  469-  487 (28.58/25.58)	SLFS.TGFLSLRAHLTRtEP
  513-  531 (29.07/20.03)	SIFSaTPTVSDRSDLER.NP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.38|      14|     552|      70|      84|       7
---------------------------------------------------------------------------
   70-   84 (28.05/21.27)	KGPPeLPH..............ITQGFFP
  624-  651 (22.33/11.35)	KGPP.VPHgsgrgqsvlrsaqvVTDSFFP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      64.45|      20|      32|     940|     971|       8
---------------------------------------------------------------------------
  580-  601 (35.35/11.16)	FPPNVLRFTLF..SHQlwGR.NWIV
  955-  977 (29.10/39.26)	YPGDEARFQLVaaSHQ..NRlVWVL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     128.06|      39|     377|     356|     395|      12
---------------------------------------------------------------------------
  356-  395 (68.47/46.42)	LFKQATEMA.RG..PWSEClRVELLHRTLVVQYWTLKPGAKSW
  733-  774 (59.59/35.82)	LIRDTIRLAfHGvdPREKC.AIMVAYGNLVDSTATLGPLISSW
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP06489 with Med14 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MDNANIGGLRHGTGNTYPQDGLSHPRGEVVQFNGANAQDGPVHVNGVEKNASQSRSVETVSANHALRVTKGPP
2) SGSNNPGTSALETEKGTADGAKISLSDPFTTMPNDKSSLSQADTA
1
1043
73
1087










Molecular Recognition Features






MoRF SequenceStartStop




NANANA