<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06486
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MHELLLFASVPAHQHHELLQQLAGLTAMQPRHRLERRLVFKAYRKPGLTTTRVGASQDLQGVELQRLNKMLNGGMFYTQVVGPVANADFGGNPSSSGDPDVSMSGLEEKPSSSSSSYSYEDQPWKLEFRDIPEAGTRSAVTARLMASATLPKGDITAPMNAWGYSFVTEYVVEGDVFVLNDIVIFLHRVLLYPTGTQESHGPRRQLPAYQELSPLERTGSYVLQAAITVQDGGNQEMMRTASQHLFGLREQLKSAVRLEMADRLSLDTRAK |
| Length | 271 |
| Position | Head |
| Organism | Aspergillus niger |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Circumdati.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.353 |
| Instability index | 43.37 |
| Isoelectric point | 6.45 |
| Molecular weight | 30047.72 |
| Publications | PubMed=26893421
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU364150
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP06486
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.75| 13| 14| 84| 96| 1
---------------------------------------------------------------------------
84- 96 (23.38/15.07) VANADFGGNPSSS
101- 113 (22.37/14.14) VSMSGLEEKPSSS
---------------------------------------------------------------------------
|