<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06459
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MDKSSLNNNFTFNNLVNLEKHLESLIHNLHDLSIIINNFEDPKTNQTVFNKIKDIINNYKFLYTNKVFTSETIPQDIIDYIEDGRNPDVYTRQFSELVQKDNQYVNGKSIAVTNFRNILAQDIKNNFPNMINEVEKILKNTNKN |
| Length | 144 |
| Position | Middle |
| Organism | Pneumocystis jirovecii (strain RU7) (Human pneumocystis pneumonia agent) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Taphrinomycotina>
Pneumocystidomycetes> Pneumocystidaceae> Pneumocystis.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.656 |
| Instability index | 23.42 |
| Isoelectric point | 5.89 |
| Molecular weight | 16898.78 |
| Publications | PubMed=26899007
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP06459
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 76.79| 19| 19| 36| 54| 1
---------------------------------------------------------------------------
17- 31 (18.07/ 6.63) ..NLE..KHLESLIHN...LHD
36- 54 (33.50/17.04) INNFEDPKTNQTVFNK...IKD
56- 76 (25.22/11.46) INNYKFLYTNK.VFTSetiPQD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.59| 19| 21| 84| 104| 2
---------------------------------------------------------------------------
80- 103 (23.89/20.56) YiedGRNPDVytRQFSELVQKD..NQ
104- 126 (22.69/12.28) Y.vnGKSIAV..TNFRNILAQDikNN
---------------------------------------------------------------------------
|