<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06456
| Description |
Uncharacterized protein |
| Sequence | MDEEQDHLKQLTNIEKAYSIININYFLLIKENILFIKRREYMALLEDISVQLRNQAKALEEAQVPINTIPKLQDFAKEKNIEHWRKIETFLKKLQLSNQK |
| Length | 100 |
| Position | Head |
| Organism | Pneumocystis jirovecii (strain RU7) (Human pneumocystis pneumonia agent) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Taphrinomycotina>
Pneumocystidomycetes> Pneumocystidaceae> Pneumocystis.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.546 |
| Instability index | 73.99 |
| Isoelectric point | 7.94 |
| Molecular weight | 12012.82 |
| Publications | PubMed=26899007
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP06456
No repeats found
|