<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06456
Description |
Uncharacterized protein |
Sequence | MDEEQDHLKQLTNIEKAYSIININYFLLIKENILFIKRREYMALLEDISVQLRNQAKALEEAQVPINTIPKLQDFAKEKNIEHWRKIETFLKKLQLSNQK |
Length | 100 |
Position | Head |
Organism | Pneumocystis jirovecii (strain RU7) (Human pneumocystis pneumonia agent) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Taphrinomycotina>
Pneumocystidomycetes> Pneumocystidaceae> Pneumocystis.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.546 |
Instability index | 73.99 |
Isoelectric point | 7.94 |
Molecular weight | 12012.82 |
Publications | PubMed=26899007
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP06456
No repeats found
|