<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06448
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MQDQSLETELSSTFPLPPQHYKLFTDHNLLAFKENQYDAIRDVDHSDMPDTVNTSGPILARFFTPPKVPTEGFYQCFHERWKIPDELPSLTEFGIQQLFDAKNGPLCAQERIAELKKMLKSLLLNFLELLGIMGIAPEQFVEKVEHIRILLLNMHHLINEYRPHQARHTLCCLVEKQVQEEKEKLLAYQNVCDDVKRILSMYQLLTK |
Length | 207 |
Position | Middle |
Organism | Pneumocystis jirovecii (strain RU7) (Human pneumocystis pneumonia agent) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Taphrinomycotina>
Pneumocystidomycetes> Pneumocystidaceae> Pneumocystis.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.343 |
Instability index | 47.26 |
Isoelectric point | 5.71 |
Molecular weight | 24163.67 |
Publications | PubMed=26899007
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
Repeats |
>MDP06448
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.25| 23| 26| 108| 130| 1
---------------------------------------------------------------------------
108- 130 (35.64/19.45) AQERIAELKKMLKSLLLNFLELL
136- 158 (39.61/22.20) APEQFVEKVEHIRILLLNMHHLI
---------------------------------------------------------------------------
|