<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06442
| Description |
Uncharacterized protein |
| Sequence | MHDDWPTTAQTDVMRIYRAKRDQSRRTVQSKYTILGFISSGTYGRVYKAQSQDGSGTIHAIKKFKPDKEGDVITYTGISQSAIREIALNREINHENVVALKEVILEDKSIYMVFDYAEHDFLQVIHHHSQTLRYPIPTAILKSLIYQLLNGLIYLHSCHILHRDLKPANILITSSGVVKIGDLGLARLIYEPLQPLFAGDKVVVTIWYRAPELLLGAKHYGKPIDCWAVGCVLAELASLRPIFKGEEAKMDGKKNVPFQKDQLLKIFEVLGTPETGIWPGLADMPEYTNMMRLDRFPCRLPEWCQSRIRSQEGYNLLRQLFVYDPDRRLTARAALQHAWFQEEPLPTWNAFAAVNNTHQIPPHRRITQDDAPSMVPAQAQNNTRGPGAPFAQAGSATTSFASVSGGGVYTGASGAGPARKKARVG |
| Length | 425 |
| Position | Kinase |
| Organism | Moniliophthora roreri |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Marasmiaceae> Moniliophthora.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.292 |
| Instability index | 43.03 |
| Isoelectric point | 9.16 |
| Molecular weight | 47591.01 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP06442
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.55| 12| 41| 141| 152| 1
---------------------------------------------------------------------------
141- 152 (20.58/13.78) LKSLIYQLLNGL
185- 196 (21.96/15.17) LARLIYEPLQPL
---------------------------------------------------------------------------
|