Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MDVSDLHPPDDYSHRFFIWHEWIQANGPLTTENVFEYFTTSMFYDKQSNNQVLRMQTIHTGMPVVNEAEELKRVMPPPSLFIIHKRERLSPEEVKPLAAYFIMNNRIYQAPDVYTVLSNRLLTSIYSIQTSLETLRTHRPDYTPRTGFVWPIIDPSLADDGNKKQDELSQIDETEESSASKAKATNASGTQKKQQNNMLLMNAMRATAAHSKSALSSSALARSAESVPMDTSAIAATNRSSSTPGPAASVASRGTTPKPPFESSSKVVPGAGKKKRKRTILANSPESSS |
Length | 289 |
Position | Head |
Organism | Moniliophthora roreri |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Agaricomycetidae> Agaricales> Marasmiaceae> Moniliophthora. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.583 |
Instability index | 49.89 |
Isoelectric point | 8.94 |
Molecular weight | 32048.69 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP06440 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 37.59| 13| 15| 222| 235| 1 --------------------------------------------------------------------------- 222- 235 (16.72/ 9.40) RSAeSVPMDTSAIA 239- 251 (20.87/ 8.25) RSS.STPGPAASVA --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 54.19| 16| 17| 71| 86| 2 --------------------------------------------------------------------------- 71- 86 (29.99/17.84) LKR..VMPPPSLFIIHKR 89- 106 (24.21/13.21) LSPeeVKPLAAYFIMNNR --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 35.06| 12| 22| 253| 265| 4 --------------------------------------------------------------------------- 253- 265 (19.67/17.19) RGTTPK.........PPfESSS 269- 289 (15.39/ 6.89) PGAGKKkrkrtilanSP.ESSS --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FVWPII 2) PPFESSSKVVPGAGKKKRKRTILANSPESS | 148 259 | 153 288 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab