<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06440
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MDVSDLHPPDDYSHRFFIWHEWIQANGPLTTENVFEYFTTSMFYDKQSNNQVLRMQTIHTGMPVVNEAEELKRVMPPPSLFIIHKRERLSPEEVKPLAAYFIMNNRIYQAPDVYTVLSNRLLTSIYSIQTSLETLRTHRPDYTPRTGFVWPIIDPSLADDGNKKQDELSQIDETEESSASKAKATNASGTQKKQQNNMLLMNAMRATAAHSKSALSSSALARSAESVPMDTSAIAATNRSSSTPGPAASVASRGTTPKPPFESSSKVVPGAGKKKRKRTILANSPESSS |
| Length | 289 |
| Position | Head |
| Organism | Moniliophthora roreri |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Marasmiaceae> Moniliophthora.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.583 |
| Instability index | 49.89 |
| Isoelectric point | 8.94 |
| Molecular weight | 32048.69 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP06440
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.59| 13| 15| 222| 235| 1
---------------------------------------------------------------------------
222- 235 (16.72/ 9.40) RSAeSVPMDTSAIA
239- 251 (20.87/ 8.25) RSS.STPGPAASVA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.19| 16| 17| 71| 86| 2
---------------------------------------------------------------------------
71- 86 (29.99/17.84) LKR..VMPPPSLFIIHKR
89- 106 (24.21/13.21) LSPeeVKPLAAYFIMNNR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.06| 12| 22| 253| 265| 4
---------------------------------------------------------------------------
253- 265 (19.67/17.19) RGTTPK.........PPfESSS
269- 289 (15.39/ 6.89) PGAGKKkrkrtilanSP.ESSS
---------------------------------------------------------------------------
|