Description | Uncharacterized protein |
Sequence | MLQELSNMDRITQLQDEIQQLLLIMSSSIRYLTSRSNFLQVSPDIPVTKQRNPEKYDTPEVFEANKQELVADLIVKAKQVEYLIQSLPEPEPEEEQAKRLQALEEEMQKANAEYIQAVNRTKALHTQVSELLRLMLTEVDTDLVNGMPEG |
Length | 150 |
Position | Middle |
Organism | Moniliophthora roreri |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Agaricomycetidae> Agaricales> Marasmiaceae> Moniliophthora. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.522 |
Instability index | 68.03 |
Isoelectric point | 4.56 |
Molecular weight | 17270.46 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP06430 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 73.83| 25| 30| 59| 85| 1 --------------------------------------------------------------------------- 59- 85 (32.04/23.74) PEVFEANKQELVADLIVKAkQVEYlIQ 92- 116 (41.79/22.31) PEEEQAKRLQALEEEMQKA.NAEY.IQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) QAKRL 2) RNPEKY 3) VFEANKQELVADLIVKAKQV | 96 51 61 | 100 56 80 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab