<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06410
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MNRQKKVKMIYCFNMNVHGSSQITNPLHIQWNPPWNPNWLSASNVLDCFTNTLNPFYDPNCLNEQVRIQRLSSEILSRVHGVEYILLHAAEPLFVIRKQYRQPNQNVTPLEDYYIIGGTVYQAPDLSSVFNSRLQSAISNVRSAFEEGIRFFSYFNAKVTCDCFCIIAKSYYRFNTSDGYYFQYKNEPPVEKVDTKKDDKTGDDKRVSVFQKYRMDMLLNELSEKFPPALSLEESNENTQNGKMTSNEEPQTSAQSKNDQMESPALSASKKIKSDMN |
| Length | 277 |
| Position | Head |
| Organism | Trichinella sp. T8 |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Enoplea> Dorylaimia>
Trichinellida> Trichinellidae> Trichinella> unclassified Trichinella.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.660 |
| Instability index | 41.47 |
| Isoelectric point | 6.90 |
| Molecular weight | 32018.70 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP06410
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 109.98| 36| 60| 175| 217| 2
---------------------------------------------------------------------------
175- 217 (53.14/40.44) NTSDGyyfqyK...NEPPVEKVDTKKDDKtgDDKRVSVFQKYRMDM
238- 276 (56.84/27.30) NTQNG.....KmtsNEEPQTSAQSKNDQM..ESPALSASKKIKSDM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.31| 14| 64| 25| 38| 4
---------------------------------------------------------------------------
13- 34 (22.07/10.92) FNMNvhgssqitNPLHIQWNPP
35- 56 (21.24/10.28) WNPNwlsasnvlDCFTNTLNPF
---------------------------------------------------------------------------
|