<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06365

Description U5 small nuclear ribonucleoprotein 40 kDa protein
SequenceMTRHQKNATASTVYSYHERKKDQKASGYGTLEERLEKAALKDFDCCSLTLQRCKDPVVNQDGYLFEYEAILKYILHQKKEIARKSKLYANYLEKKQQEEVEMQNAEYNKKVRKFVASEATPARRMNVEDDSSLATTSTGLGNQKSRSFWVPGSEMAKESAVEKPDTKVLCPVTGKELKMKNLTHIKFTLANGIQESEVFTKKDVYVCALTGDILTNSVPCAVLKTSGNVITVSALEKVVKKDMIDPFNGRKLTDKDIILLQRGGTGFAATNEKLNAKLSRPIFSAIMNHPGNAVAIVHPSKPHEVVSHSEEQKRSSHLMAPIMSLIGHEGEIYAAAFSYDGTMLASGVLWNVYGECENFALLSGHNGAIMELHFSADNNVLFTCSTDKTVRLWDMETGVCIRNFKGHTSFVNSCHPARRGPQLVCSGSDDGTIKVWDKRQKKCIYSFENVYQVTAVTFNDTAEQIVSGGIENDLKIWDIRKESPMFTLRGHGDTVTGLSLSPDGSHVLSNAMDCTVRIWDIRPFAPVNRCVAVLQGAQHNFEKNLLRCAWSPDGMKASSGSADRFVYIWDLNSRRVQYKLPGHFGSVNVTAFHPCEPIVWLSKSTCIFENLAFEHWLLLNGDFSNGDGLLIWRNRPAVVIGRHQNPWLEANLEWAKEADVDVARRHSGGGTVYHDMQNMNVSFLTTNKRYNRLRNLSLVRQTVERITGLQLAINDKHDLLLCGHKISGTAAKLTSNAAYHHLTVMLDVNLKRLSRALNSNIHGVLTNATESRRSSVTSLRQFQPELNYDQLVEAVVEDFARNYESCQVENVFHIDDAHFVNISDNVEQLKSWNWRFGQSPKFVLDRVLRPRSQFECRLRVTVVHGLIERIELIKKNQISAAFSEAALFTGIPFHTDALEQIIISAIHSLMDEGRKNISARKAMLLKEYQVLLQRSVKSIRENFTEIIKMAKIGDDGQVSRLTEYEHELFEMQIRAANMTHAAEALIKMVTDLKQFLILNDFAYINESITTSAVHNQIAQREFRDKLIAVKEEMTYCLQEAEQEYYNTALKNSVSYLKLNF
Length1060
PositionHead
OrganismTrichinella papuae
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Enoplea> Dorylaimia> Trichinellida> Trichinellidae> Trichinella.
Aromaticity0.08
Grand average of hydropathy-0.335
Instability index34.84
Isoelectric point8.28
Molecular weight119807.27
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
cellular protein modification process	GO:0006464	IEA:InterPro
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP06365
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
            10|     402.05|      40|      40|     362|     401|       1
---------------------------------------------------------------------------
  289-  322 (27.86/12.12)	.......HP..GnAVAIVHPSKPHEVV........SH..SEEQKRSS.....HLMA....P.....I
  323-  359 (33.71/16.12)	MSliG..HE..G.EIYAAAFSYDGTML...............ASGVL.....WNV.....YGECenF
  362-  401 (63.32/36.35)	LS..G..HN..G.AIMELHFSADNNVLF.......TC..STDKTVRL.....WDME....TGVC..I
  404-  444 (46.98/25.18)	FK..G..HT..S.FVNSCH.PARRGPQL.......VCsgSDDGTIKV.....WDKR....QKKC..I
  445-  485 (39.58/20.13)	YS..F..EN.vY.QVTAVTFNDTAEQIV.......SG..GIENDLKI.....WDIR....KESP..M
  488-  531 (50.05/27.28)	LR..G..HG..D.TVTGLSLSPDGSHVL.......SN..AMDCTVRI.....WDIRpfapVNRC..V
  534-  577 (42.91/22.41)	LQ..GaqHNfeK.NLLRCAWSPDGMKAS.......SG..SADRFVYI.....WDLN....SRRV..Q
  580-  607 (38.56/19.43)	LP..G..HF..G.S...........VNV.......TA..FHPCEPIV.....W.LS....KSTC..I
  611-  662 (30.50/13.92)	LA..F..EH..W.LLLNGDFSNGDGLLIwrnrpavVI..GRHQNPWLeanleWAKE....ADVD..V
  663-  696 (28.58/12.61)	AR..R..HS..G.GGTVYHDMQNMNVSF.......LT..TNKRYNRL.....RNL............
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      98.12|      30|      36|     108|     142|       3
---------------------------------------------------------------------------
  110-  139 (49.01/41.76)	KVRKFVASEATPARRMNVE.DDSSLATTSTG
  144-  174 (49.11/25.54)	KSRSFWVPGSEMAKESAVEkPDTKVLCPVTG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      86.41|      28|      36|     188|     223|       4
---------------------------------------------------------------------------
  188-  216 (42.98/45.88)	TLANGIQES..EVFTKKDVyVCALTGDILTN
  225-  254 (43.43/23.34)	TSGNVITVSalEKVVKKDM.IDPFNGRKLTD
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP06365 with Med22 domain of Kingdom Metazoa
Unable to open file!