<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06339

Description Mediator of RNA polymerase II transcription subunit 26 (Fragment)
SequenceLKHGDSVQANASVAGGAFKGSPVKLLGQREEGTLKFDLSTVFLKHGDSVQANASVAGGAFKGSPVKLLGQREEESSKVMLLFFSFQVNNVAKACEAMDAIESVVMTKESLESSRLGLLINEVRRSNQLLHPDLAKRCRLLIKKWRKLISTTPTPTPTPTTTTQPAITDNGVDTAGVAPVAADDRAIRIRIKLGSSVNEATILGGQEKKQQQQQQQLDNCGIEQAENRRKRKHISQNAPNNSKMNGISKTHLSAIGGNGGGSGETFSLASTVSKPCKPPRSSSSCSRPVPLPTAPASQPRHPPPPQPPLPPPSAPTPPPPPPPPPPPQSSPPPLPPSPPPPTPPPPPPPSTSPSLTTTSSRPPKLKTTAQLVADLTKCYPEELLVNINTSIGVDSTNALQQATASNSGDDAPSPALLFSAVEHQQPNGGGGGEVNKLELLEKYLAEDADQQQQNQDHVVAGSSSGVCTSSSSVDSDTSSRSSTPSRDKIVRASDDDDDDAPPRSGPDTVSSPSDGGGKPGLVDDGRRPIRRLPPVDRSMLDRLDEIPSPSKSRVSSLKYLDDYSNEPPERTRALAPFEQSLRMLPSEMRQLHSRVLVKTTDGRQVLALPYVDIGLPDFLEYDNSPATTEQLISWEAIRW
Length638
PositionUnknown
OrganismTrichinella nativa
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Enoplea> Dorylaimia> Trichinellida> Trichinellidae> Trichinella.
Aromaticity0.03
Grand average of hydropathy-0.627
Instability index68.80
Isoelectric point7.24
Molecular weight67965.40
Publications









Function






Annotated function


GO - Cellular Component
nucleus	GO:0005634	IEA:InterPro

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP06339
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     152.17|      38|      40|       1|      38|       1
---------------------------------------------------------------------------
    1-   38 (76.41/47.07)	LKHGDSVQANASVAGGAFKGSPVKLLGQREEGTLKFDL
   43-   80 (75.77/46.62)	LKHGDSVQANASVAGGAFKGSPVKLLGQREEESSKVML
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     119.48|      20|      20|     306|     325|       2
---------------------------------------------------------------------------
  282-  304 (31.97/ 6.84)	SScsrPVPLPTAPASQPRHPPPP
  305-  324 (47.54/13.83)	QP...PLPPPSAPTPPPPPPPPP
  325-  345 (39.96/10.43)	PP..qSSPPPLPPSPPPPTPPPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.23|      13|      15|     532|     544|       3
---------------------------------------------------------------------------
  532-  544 (24.48/12.58)	PPVDR.SMLDRLDE
  548-  561 (18.75/ 8.08)	PSKSRvSSLKYLDD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.26|      15|      15|     350|     364|       4
---------------------------------------------------------------------------
  350-  364 (26.01/14.39)	TSPSLTT..TSSRPPKL
  366-  382 (21.25/10.34)	TTAQLVAdlTKCYPEEL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.56|      20|      26|     461|     486|       5
---------------------------------------------------------------------------
  465-  484 (35.05/23.82)	VCTSSSSVDSDTSSRS.....STPS
  488-  512 (30.51/ 6.05)	IVRASDDDDDDAPPRSgpdtvSSPS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP06339 with Med26 domain of Kingdom Metazoa
Unable to open file!