<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06335
Description |
Endoplasmic reticulum-Golgi intermediate compartment protein 2 (Fragment) |
Sequence | LTLYVDLTVATKCEYLATSMDGVKQKSPASSEEISMVPVRFKLSPDAQLYWNMLRNVRELHVPERLHHLSERNSLGFEIWRHLHEFAVDRQNNASSTETAIVDACRIHGYFLMNKLRGKLRIKFKETVRLEAVSNFFIFARRQNEGFNFSHRIEKFGFGPRIAGIINPLDGFQKESFDRRDMFYYYIQVVPTKITDLNGMETFTSQYSVTHKRRIIDHDQGSHGSCGIFIYFDFAPMMVLIRKSKTSLFVFALRICAIVGGIFACTGNCMEEYNGDVINNFRQAVKSCLTLLSVPVKTRHIEADEIKTTAEVATHRLIEAARRSERHFVRLYALFSAYCPEEVLKEEINDMKQEIERKKNMLLKHEEKMIAWEQILSEAETPLTS |
Length | 385 |
Position | Head |
Organism | Trichinella nativa |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Enoplea> Dorylaimia>
Trichinellida> Trichinellidae> Trichinella.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.265 |
Instability index | 51.56 |
Isoelectric point | 8.52 |
Molecular weight | 44630.90 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP06335
No repeats found
|