<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06330
| Description |
Mediator of RNA polymerase II transcription subunit 27 |
| Sequence | MYKPERPDIKFTIAEVNNSARRSKSIGQYHTILNNTFCRSCGVTSLISVLKDDLPFSVVRKIYPMNQNQSSTVSVPVELAEVTVMQGLRAVRDLRQSMSRLFDTLKDIRETPVTDEKAEESDLWLNFKSTLQKIMDNFEILEKCAVSLSKQPVQFLHPNLNQQIRSYCTDEAQIYPDIVYVYEWVKRIRESAQWLYNFVSQMSRRSQSRFLSHLFPMIQRQFPGVHIFSLPLGRSVFMLLVSFNVQTSAVDALRGPCTIFKVAILLRGLQIEWANVKGPEELNQNCLEKVFIYLTLCIFY |
| Length | 300 |
| Position | Tail |
| Organism | Trichinella nativa |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Enoplea> Dorylaimia>
Trichinellida> Trichinellidae> Trichinella.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.122 |
| Instability index | 53.00 |
| Isoelectric point | 8.91 |
| Molecular weight | 34768.89 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP06330
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.75| 14| 69| 120| 133| 1
---------------------------------------------------------------------------
120- 133 (26.17/16.89) ESDLWL.NFKSTLQK
190- 204 (22.58/13.68) ESAQWLyNFVSQMSR
---------------------------------------------------------------------------
|