Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MSFNVKIYLQMNVHGSSQITNPLHIQWNPPWNPNWLSASNVLDCFTNTLNPFYDPNCLNEQVRIQRLSSEILSRVHGVEYILLHAAEPLFVIRKQYRQPNQNVTPLEDYYIIGGTVYQAPDLSSVFNSRLQSAISNVRSAFEEAKSYYRFNTSDGYYFQYKNEPPVEKVDTKKDDKTGDDKRVSVFQKYRMDMLLNELSEKFPPALSLEESNENTQDGKMTSNEEPQTSAQSKNDQMESPALSASKKIKSDMN |
Length | 253 |
Position | Head |
Organism | Trichinella nativa |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Enoplea> Dorylaimia> Trichinellida> Trichinellidae> Trichinella. |
Aromaticity | 0.10 |
Grand average of hydropathy | -0.743 |
Instability index | 47.03 |
Isoelectric point | 5.48 |
Molecular weight | 29129.19 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP06314 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 135.98| 32| 59| 162| 193| 1 --------------------------------------------------------------------------- 162- 193 (54.71/33.90) NEPPVEKVDTKKDDKTGDDKRVSVFQKYRMDM 201- 222 (34.23/18.89) KFPPALSLE.ESNENTQDGK.........MTS 223- 252 (47.04/28.28) NEEPQTSAQSKNDQM..ESPALSASKKIKSDM --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 112.77| 22| 63| 13| 34| 2 --------------------------------------------------------------------------- 13- 34 (44.28/23.42) VHGSSQI....TNPLHIQWNPPWNPN 35- 56 (37.44/18.93) WLSASNV....LDCFTNTLNPFYDPN 75- 100 (31.05/14.75) VHGVEYIllhaAEPLFVIRKQYRQPN --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GYYFQYKN 2) KNDQMESPALSASKKIKSDMN 3) LEDYYII 4) YRMDMLLNELSEKFPP | 155 233 106 189 | 162 253 112 204 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab