<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06274

Description Mediator of RNA polymerase II transcription subunit 8
SequenceMMELRDVLYATPYRPKSSAAHVFESIKPRPILNITPECSEDEDCNSGTSGKDSDKMLKREIAYSSPNSCSRGKQLNKPFLNTCEALIEKIKRVKKIDPSTLAKEQIRRNEHYYQKIAMKKILLVLYLDKKMQEIDKNFINSVGSIVQNIKSIQSSISEVLAKLQMVEQPSLLNSFRVISSQFNSVLQLLRSDRASHFKNYVFLPIRLSVEVDADLEAATENRLHAWTHAVVPDYLRTKPDPQVEQKDQQISNQVQQRICNPESLLKQVTAFNRCLNCILDSLNASIRDSEMDGRKTSKTSDSEDTALLVAAILKGQNVKPAYSATPTSSRGSSGDSGHSKSSKAPVRIATTHHPVPYNR
Length359
PositionHead
OrganismTrichinella zimbabwensis
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Enoplea> Dorylaimia> Trichinellida> Trichinellidae> Trichinella.
Aromaticity0.05
Grand average of hydropathy-0.531
Instability index48.88
Isoelectric point9.21
Molecular weight40349.57
Publications

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP06274
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     105.71|      33|     114|     128|     164|       1
---------------------------------------------------------------------------
   73-  105 (54.02/32.60)	KQLNKPFLNTCEALIEKIKRVKKIDPSTLAKEQ
  132-  164 (51.69/30.52)	QEIDKNFINSVGSIVQNIKSIQSSISEVLAKLQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     122.90|      39|     258|      32|      72|       2
---------------------------------------------------------------------------
   32-   72 (68.17/61.19)	LNITPECSE.DEDCNSGTSGKDSDKML..........KreIAYSSPNSCSRG
  282-  331 (54.73/41.42)	LNASIRDSEmDGRKTSKTSDSEDTALLvaailkgqnvK..PAYSATPTSSRG
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP06274 with Med8 domain of Kingdom Metazoa

Unable to open file!