<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06233
Description |
Mediator of RNA polymerase II transcription subunit 24 (Fragment) |
Sequence | LMAIRDEMRKELHVQEGQPTINLVLRAEFTLQSIVKAFDAHQALERWPQMLNTMMSGKSLLYICAAAISIDQLNLLAERLIKITETYKEVVPVGEDAQKSVPPSHDLFDMSFLLLHRLSQYYSTTTCLRPGDPFFKTWYFSSAIDLVRNMFDPEDLPQLLKNVPLDLELATDVLSRLRVGQPGWLNIRTWYCIIDLIPSIVQVVLNEVLLDTISIEELKVCKQSL |
Length | 225 |
Position | Tail |
Organism | Trichinella britovi (Parasitic roundworm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Enoplea> Dorylaimia>
Trichinellida> Trichinellidae> Trichinella.
|
Aromaticity | 0.08 |
Grand average of hydropathy | 0.090 |
Instability index | 45.80 |
Isoelectric point | 5.13 |
Molecular weight | 25790.80 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP06233
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.90| 18| 49| 128| 147| 1
---------------------------------------------------------------------------
128- 147 (32.58/24.78) LRPGDPFF...KTWYfsSAIDLV
177- 197 (34.32/19.64) LRVGQPGWlniRTWY..CIIDLI
---------------------------------------------------------------------------
|