| Description | Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MNVHGSSQITNPLHIQWNPPWNPNWLSASNVLDCFTNTLNPFYDPNCLNEQVRIQRLSSEILSRVHGVEYILLHAAEPLFVIRKQYRQPNQNVTPLEDYYIIGGTVYQAPDLSSVFNSRLQSAISNVRSAFEEAKSYYRFNTSDGYYFQYKNEPPVEKVDTKKDDKTGDDKRVSVFQKYRMDMLLNELSEKFPPALSLEESNENTQDGKMTSNEEPQTSAQSKNDQMESPALSASKKIKSDMN |
| Length | 243 |
| Position | Head |
| Organism | Trichinella britovi (Parasitic roundworm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Enoplea> Dorylaimia> Trichinellida> Trichinellidae> Trichinella. |
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.791 |
| Instability index | 45.87 |
| Isoelectric point | 5.32 |
| Molecular weight | 27904.72 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP06226
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 135.98| 32| 59| 152| 183| 1
---------------------------------------------------------------------------
152- 183 (54.71/30.99) NEPPVEKVDTKKDDKTGDDKRVSVFQKYRMDM
191- 212 (34.23/17.21) KFPPALSLE.ESNENTQDGK.........MTS
213- 242 (47.04/25.83) NEEPQTSAQSKNDQM..ESPALSASKKIKSDM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 112.77| 22| 63| 3| 24| 2
---------------------------------------------------------------------------
3- 24 (44.28/24.65) VHGSSQI....TNPLHIQWNPPWNPN
25- 46 (37.44/19.93) WLSASNV....LDCFTNTLNPFYDPN
65- 90 (31.05/15.53) VHGVEYIllhaAEPLFVIRKQYRQPN
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) GYYFQYK 2) LEDYYII 3) MESPALSASKKIKSDMN 4) MLLNELSEKFP | 145 96 227 183 | 151 102 243 193 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab