Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MNVHGSSQITNPLHIQWNPPWNPNWLSASNVLDCFTNTLNPFYDPNCLNEQVRIQRLSSEILSRVHGVEYILLHAAEPLFVIRKQYRQPNQNVTPLEDYYIIGGTVYQAPDLSSVFNSRLQSAISNVRSAFEEAKSYYRFNTSDGYYFQYKNEPPVEKVDTKKDDKTGDDKRVSVFQKYRMDMLLNELSEKFPPALSLEESNENTQDGKMTSNEEPQTSAQSKNDQMESPALSASKKIKSDMN |
Length | 243 |
Position | Head |
Organism | Trichinella britovi (Parasitic roundworm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Enoplea> Dorylaimia> Trichinellida> Trichinellidae> Trichinella. |
Aromaticity | 0.10 |
Grand average of hydropathy | -0.791 |
Instability index | 45.87 |
Isoelectric point | 5.32 |
Molecular weight | 27904.72 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP06226 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 135.98| 32| 59| 152| 183| 1 --------------------------------------------------------------------------- 152- 183 (54.71/30.99) NEPPVEKVDTKKDDKTGDDKRVSVFQKYRMDM 191- 212 (34.23/17.21) KFPPALSLE.ESNENTQDGK.........MTS 213- 242 (47.04/25.83) NEEPQTSAQSKNDQM..ESPALSASKKIKSDM --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 112.77| 22| 63| 3| 24| 2 --------------------------------------------------------------------------- 3- 24 (44.28/24.65) VHGSSQI....TNPLHIQWNPPWNPN 25- 46 (37.44/19.93) WLSASNV....LDCFTNTLNPFYDPN 65- 90 (31.05/15.53) VHGVEYIllhaAEPLFVIRKQYRQPN --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GYYFQYK 2) LEDYYII 3) MESPALSASKKIKSDMN 4) MLLNELSEKFP | 145 96 227 183 | 151 102 243 193 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab