<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06225
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MNVHGSSQITNPLHIQWNPPWNPNWLSASNVLDCFTNTLNPFYDPNCLNEQVRIQRLSSEILSRVHGVEYILLHAAEPLFVIRKQYRQPNQNVTPLEDYYIIGGTVYQAPDLSSVFNSRLQSAISNVRSAFEEGIRFLSYFNAKVTCDCFCIIAKSYYRFNTSDGYYFQYKNEPPVEKVDTKKDDKTGDDKRVSVFQKYRMDMLLNELSEKFPPALSLEESNENTQDGKMTSNEEPQTSAQSKNDQMESPALSASKKIKSDMN |
| Length | 263 |
| Position | Head |
| Organism | Trichinella britovi (Parasitic roundworm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Enoplea> Dorylaimia>
Trichinellida> Trichinellidae> Trichinella.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.652 |
| Instability index | 42.91 |
| Isoelectric point | 5.48 |
| Molecular weight | 30200.46 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP06225
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.70| 20| 64| 161| 185| 1
---------------------------------------------------------------------------
161- 185 (28.84/24.56) NTSDGyyfqyK...NEPPVEKVDTKKDD
224- 246 (29.86/13.66) NTQDG.....KmtsNEEPQTSAQSKNDQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 112.77| 22| 64| 3| 24| 2
---------------------------------------------------------------------------
3- 24 (44.28/25.90) VHGSSQI....TNPLHIQWNPPWNPN
25- 46 (37.44/20.94) WLSASNV....LDCFTNTLNPFYDPN
65- 90 (31.05/16.32) VHGVEYIllhaAEPLFVIRKQYRQPN
---------------------------------------------------------------------------
|