Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MNVHGSSQITNPLHIQWNPPWNPNWLSASNVLDCFTNTLNPFYDPNCLNEQVRIQRLSSEILSRVHGVEYILLHAAEPLFVIRKQYRQPNQNVTPLEDYYIIGGTVYQAPDLSSVFNSRLQSAISNVRSAFEEGIRFLSYFNAKVTCDCFCIIAKSYYRFNTSDGYYFQYKNEPPVEKVDTKKDDKTGDDKRVSVFQKYRMDMLLNELSEKFPPALSLEESNENTQDGKMTSNEEPQTSAQSKNDQMESPALSASKKIKSDMN |
Length | 263 |
Position | Head |
Organism | Trichinella britovi (Parasitic roundworm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Enoplea> Dorylaimia> Trichinellida> Trichinellidae> Trichinella. |
Aromaticity | 0.11 |
Grand average of hydropathy | -0.652 |
Instability index | 42.91 |
Isoelectric point | 5.48 |
Molecular weight | 30200.46 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP06225 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 58.70| 20| 64| 161| 185| 1 --------------------------------------------------------------------------- 161- 185 (28.84/24.56) NTSDGyyfqyK...NEPPVEKVDTKKDD 224- 246 (29.86/13.66) NTQDG.....KmtsNEEPQTSAQSKNDQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 112.77| 22| 64| 3| 24| 2 --------------------------------------------------------------------------- 3- 24 (44.28/25.90) VHGSSQI....TNPLHIQWNPPWNPN 25- 46 (37.44/20.94) WLSASNV....LDCFTNTLNPFYDPN 65- 90 (31.05/16.32) VHGVEYIllhaAEPLFVIRKQYRQPN --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KNDQMESPALSASKKIKSDMN 2) MLLNELSEKFPPALSLE | 243 203 | 263 219 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab