<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06217
| Description |
Endoplasmic reticulum-Golgi intermediate compartment protein 2 |
| Sequence | MERLDAFPKIRQSVRMEYSASHAIYFCKVFLAFLVIVIWLIYCEFLYFSEIYYAYTFTVDTSFKEYGGAFDFFAVGFSVYSQLTLYVDLTVATKCEYLATSMDGVKQKSLASSEEISMVPVRFKLSPDAQLYWNMLRNVRELHVPERLHHLSERNSLGFEIWRHLHEFAVDRQNNASTTETAIVDACRIHGYFLMNKLRGKLRIKFKETVRLEAVSNFFIFARRQNEGFNFSHRIEKFGFGPRIAGIINPLDGFQKESFDRRDMFYYYIQVVPTKITDLNGMETFTSQYSVTHKRRIIDHDQGSHGSCGIFIYFDFAPMMVLIRKSKTSLFVFALRICAIVGGIFACTGNCMEEYNGDVINNFRQAVKSCLTLLSVPVKTRHIEADEIKTTAEVATHRLIEAARRSERHFVRLYALFSAYCPEEVLKEEINDMKQEIERKKNMLLKHEEKMIAWEQILSEAETPLTS |
| Length | 467 |
| Position | Head |
| Organism | Trichinella britovi (Parasitic roundworm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Enoplea> Dorylaimia>
Trichinellida> Trichinellidae> Trichinella.
|
| Aromaticity | 0.13 |
| Grand average of hydropathy | -0.113 |
| Instability index | 44.77 |
| Isoelectric point | 7.96 |
| Molecular weight | 54405.12 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP06217
No repeats found
|