Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MDESDSASVSSSQTRDSSGILRTKIALGRKPSVIMPFYMMKNELPNPSPITGSMNLLSYYGLDHAFNKFCNNKKLKEELSAFLPNLPGNIDTPAQKDGRQICSNFFVATAFRKASNMWKRNFAIKQQRFSRFSSSTWLSRKLHFDFRIPEEYQLWNVGAEIVNDKKKRKRKHELLSAGESAEDDVEKRLKRMKKEEEKKEKKKKKKDKKKKKMMESEPVYSAPVISQASDFLDF |
Length | 234 |
Position | Head |
Organism | Trichinella britovi (Parasitic roundworm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Enoplea> Dorylaimia> Trichinellida> Trichinellidae> Trichinella. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.878 |
Instability index | 55.68 |
Isoelectric point | 9.80 |
Molecular weight | 27105.89 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP06214 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 37.53| 11| 36| 165| 175| 1 --------------------------------------------------------------------------- 165- 175 (18.45/ 8.68) KKKRKRKHELL 204- 214 (19.07/ 9.17) KKKDKKKKKMM --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 138.43| 44| 47| 36| 82| 2 --------------------------------------------------------------------------- 36- 82 (70.12/59.07) PfyMMKNELPNPSPITGSmNLLSYYGLDHAFNKFCN....NKKLKEE.LSAF 84- 132 (68.31/45.21) P..NLPGNIDTPAQKDGR.QICSNFFVATAFRKASNmwkrNFAIKQQrFSRF --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KIALGRKPSVIMPF 2) VEKRLKRMKKEEEKKEKKKKKKDKKKKKMMESEPVYSAPVISQAS | 24 185 | 37 229 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab