Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MDESDSASVSSSQTRDSSGILRTKIALGRKPSVIMPFYMMKNELPNPSPITGSMNLLSYYGLDHAFNNSLRQLFEKPPICGKEILPLSNSDLAGFRLLPGSIPEEYQLWNVGAEIVNDKKKRKRKHELLSAGESAEDDVEKRLKRMKKEEEKKEKKKKKKDKKKKKMMESEPVYSAPVISQASDFLDF |
Length | 188 |
Position | Head |
Organism | Trichinella britovi (Parasitic roundworm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Enoplea> Dorylaimia> Trichinellida> Trichinellidae> Trichinella. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.814 |
Instability index | 58.81 |
Isoelectric point | 9.39 |
Molecular weight | 21369.41 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP06213 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 37.53| 11| 36| 119| 129| 1 --------------------------------------------------------------------------- 119- 129 (18.45/ 9.03) KKKRKRKHELL 158- 168 (19.07/ 9.53) KKKDKKKKKMM --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KRLKRMKKEEEKKEKKKKKKDKKKKKMMESEPVYSAPVISQASD 2) LRTKIALGRKPSVIMPFYMM | 141 21 | 184 40 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab