<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06196
Description |
Mediator of RNA polymerase II transcription subunit 24 |
Sequence | MLFSNYSQQHEVTGQQLYFGHWARSTTTTRITVVHFPKTKLNHSLYSHLGLGLASERNVRKMIHDSYMDYMIQQNQPQKNRLKEKLLYFSSMMIPQLHHFQFPDTLMAIRDEMRKELYIQEGQPTINLVLRAEFTLQSIVKAFDAHQALERWPQMLNTMMSGKSLLYICAAAISIDQLNLLAERLIKITETYKEVVPVGEDAQKSVPPSHDLFDMSFLLLHRLSQYYSTTTCLRPGDPFFKTWYFSSAIDLVRNMFDPEDLPQLLKNVPLDLELASDVLSRLRVGQPGWLNIRTWYCIIDLIPSIVQVVLNEVLLDTISIEELKVCKQSL |
Length | 330 |
Position | Tail |
Organism | Trichinella spiralis (Trichina worm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Enoplea> Dorylaimia>
Trichinellida> Trichinellidae> Trichinella.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.132 |
Instability index | 43.37 |
Isoelectric point | 6.60 |
Molecular weight | 38329.03 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP06196
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 116.34| 41| 48| 72| 119| 1
---------------------------------------------------------------------------
8- 77 (48.64/35.68) QQHEVTGQQLYFGhwarSTTTTRITVVHFP......KTKLNHSLyshlglglasernvrkmihdsymdYMIQqNQP
78- 124 (67.70/58.86) QKNRLKEKLLYFS....SMMIPQLHHFQFPdtlmaiRDEMRKEL........................YIQE.GQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.90| 18| 49| 233| 252| 2
---------------------------------------------------------------------------
233- 252 (32.58/27.78) LRPGDPFF...KTWYfsSAIDLV
282- 302 (34.32/21.94) LRVGQPGWlniRTWY..CIIDLI
---------------------------------------------------------------------------
|